Enzymes
SRM 130 · 2003-01-25 · by chogyonim
Problem Statement
*** WARNING: Do not leave the competition room while you are competing. If you have a question, use "admins: question" in the chat area. ***
Biologists often use enzymes to break proteins they are studying into pieces. A protein is a chain of amino acids. A protein will be represented as a
Each enzyme will be represented by a
Create a class Enzymes that contains a method split which takes as arguments a
Valid amino acids are: "ACDEFGHIKLMNPQRSTVWY".
Notes
- Proteins are directional. Therefore a enzyme can only cleave after a specific amino acid, and not before. For example, the enzyme "C" can cleave the protein "ACE" into "AC" and "E", but not into "A" and "CE".
- Once applied, an enzyme completely breaks a protein after all specified amino acids.
Constraints
- enzymes will contain between 1 and 10 elements, inclusive.
- each element of enzymes will have between 1 and 20 characters, inclusive.
- each element of enzymes will only contain capital letters representing valid amino acids, with no repetition of letters. Valid amino acids are "ACDEFGHIKLMNPQRSTVWY".
- protein will have between 1 and 50 characters, inclusive.
- each character of protein will be a capital letter which represents a valid amino acid. Valid amino acids are "ACDEFGHIKLMNPQRSTVWY".
- At least one character in each element of enzymes will be a character other than the last in protein
{"WYFLM","KR"}
"AACDDYNQQNMEREY"
Returns: 6
Using only the first enzyme, we would break the protein at 3 locations. However, one of these is after the last amino acid of the protein, so no new fragment would be created (remember also that we don't count the original protein fragment). This gives us 3 (new) fragments. Using the second enzyme we break at only one amino acid, giving us 2 fragments. Using both enzymes we break at all 3 of the previous points, giving us 4 fragments. However, 3 of these fragments (the initial "AACDDY", "NQQNM", and the final "EY") are repeated, so the total count is 6: "AACDDY", "NQQNM", "EREY", "AACDDYNQQNMER", "EY", AND "ER".
{"GMNPAC","AC","NP","GM","A","C","N","P","G","M"}
"ACCACCDDEDFGHPPQPRPCCFGGPTVWYYTSPQRMNLKIGHFEDAC"
Returns: 49
{"AFKRSTY","ADEFHILNQRT","ADGHIQRS","CDHIMNQRV","CDEFHQ",
"AGHINRSTWY","ACDEFHILNPQR","ACDGILPRSV","DFKMNQRSTVY"}
"LDVQMTLTRSIQQLYAKII"
Returns: 38
{"CEFIKLPQRVY","DFGKPRST","AHMPRST","CDIKLMPSVWY"}
"FYHKQAYDHLWRHMM"
Returns: 32
The 32 fragments are: "AY", "HMM", "LWR", "HLWR", "YDH", "YHK", "KQA", "QAYD", "WR", "Y", "RHM", "W", "FYH", "FY", "R", "Q", "QA", "YH", "M", "L", "YD", "K", "QAY", "DHL", "H", "F", "HM", "HL", "D", "DH", "HK", and "A".
{"EFHILNPQSTW","AEHIPVWY","AFHIKMNRTVW","CFHLPQRVWY","CIKMQSTW","ACDHIQRT","ACDFHILNT"}
"TVAYQQA"
Returns: 12
Submissions are judged against all 17 archived test cases, of which 5 are shown here. Case numbers match the judge’s.
Language: C++17 · define a public class Enzymes with a public method int split(vector<string> enzymes, string protein) · 17 test cases · 2 s / 256 MB per case